PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco012841.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MYB_related
Protein Properties Length: 273aa    MW: 30146.9 Da    PI: 5.3356
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco012841.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.43.7e-142767345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++++eE+   +++ +qlG++ W++Ia +++ gRt++++k++w 
      Aco012841.1 27 KFSAEEERVVIELQAQLGNK-WARIATYLP-GRTDNDVKNFWS 67
                     79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.101118IPR017877Myb-like domain
SuperFamilySSF466897.52E-19476IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-7530IPR009057Homeodomain-like
PROSITE profilePS5129420.6271974IPR017930Myb domain
SMARTSM007176.1E-122472IPR001005SANT/Myb domain
CDDcd001671.00E-102766No hitNo description
PfamPF002492.7E-122767IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-173169IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
GLLPRTGKSC RLRWVNKLKP DLKTGCKFSA EEERVVIELQ AQLGNKWARI ATYLPGRTDN  60
DVKNFWSTRQ KRLARILRTP LPTARSSKTH GAKAPLPNSH DHLQTFKDPN LDLILFEGDS  120
SGGQCSKGSC IDNQNATAIL PELSSPSFLN LETTLPMIEP AIERQSTSSK STLLSQIPFD  180
HLHYPLIDLP ALPDTPDLVS GFDIDMNSID DLTCQGDQLH HVEALSPFFG LESDDHAGKT  240
EHRVPSDIFF DDLPSDMFDS LEPPPPPASS SSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-1627237106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008807969.12e-89PREDICTED: transcription factor MYB48-like
TrEMBLK3YCT27e-76K3YCT2_SETIT; Uncharacterized protein
STRINGSi012032m2e-75(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.12e-44MYB family protein